PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C021144P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family SBP
Protein Properties Length: 298aa    MW: 32888.4 Da    PI: 8.2487
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C021144P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1308.7e-41161238178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +Cq+egC+adls+ak+yhrrhkvCe+hska++v+++gl+qrfCqqCsrfh + efD++krsCr+rLa+hn+rrrk+q+
  MELO3C021144P1 161 RCQAEGCNADLSQAKHYHRRHKVCEFHSKASTVITAGLTQRFCQQCSRFHVVGEFDNGKRSCRKRLADHNRRRRKTQQ 238
                     6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.8E-34156223IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.573159236IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.83E-37160240IPR004333Transcription factor, SBP-box
PfamPF031101.2E-30162235IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009554Biological Processmegasporogenesis
GO:0009556Biological Processmicrosporogenesis
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MLDYEWGSTN PPPIILSGEE SEPVFNSDPS HSHNFPTFID LHHHNTFFTP PPPPPPPPPS  60
TAAFSSHLGG FYDHPQSYTM GTSSYHHYNS VTGGGGEFML VPKSEDVCGS MAAPVEFAAR  120
IGLNLGGRTY FSSEEEEFVN RLYRKTRSGS EMGGSGNWAV RCQAEGCNAD LSQAKHYHRR  180
HKVCEFHSKA STVITAGLTQ RFCQQCSRFH VVGEFDNGKR SCRKRLADHN RRRRKTQQSH  240
HQGTPNSSQL LQTTPSSSTH SAATRSTMES TGQSAWSVTV AVSPTRMSLD CLNQRPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-32153235184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00090SELEXTransfer from AT1G02065Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819240.0LN681924.1 Cucumis melo genomic scaffold, anchoredscaffold00047.
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008458127.10.0PREDICTED: squamosa promoter-binding-like protein 8
RefseqXP_008458128.10.0PREDICTED: squamosa promoter-binding-like protein 8
SwissprotQ8GXL34e-64SPL8_ARATH; Squamosa promoter-binding-like protein 8
TrEMBLA0A0A0KA350.0A0A0A0KA35_CUCSA; Uncharacterized protein
STRINGPOPTR_0002s14320.11e-81(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68013348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.15e-67squamosa promoter binding protein-like 8